PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AS_124CCE880.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 841aa    MW: 94250.6 Da    PI: 8.1347
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AS_124CCE880.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA36.38e-12141177135
                   GATA   1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35 
                            C  Cg +   Tp++Rrgp g +tLCnaCG+ ++k +l
  Traes_4AS_124CCE880.2 141 CLRCGISAnaTPHMRRGPMGRRTLCNACGIAWAKGKL 177
                            5567766667***********************9876 PP

2FAR1865.7e-27211296188
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA ++GFsvrks+s ks  ++ + +rtfvCs+eg+r+++k + ++ +r+r+etr+gC a++ +k ++ +k+++++++ +HnH+
  Traes_4AS_124CCE880.2 211 EFYNRYAGHIGFSVRKSSSDKS-ADNITRSRTFVCSREGFRKDKKGA-NEVKRPRPETRIGCPARMIIKITSYNKYRIAEFVADHNHQ 296
                            6********************9.555699**************9999.99*************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.04E-9135185No hitNo description
SMARTSM004014.4E-6135188IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.7E-10139177IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.5E-9143177IPR000679Zinc finger, GATA-type
PfamPF031017.4E-24211296IPR004330FAR1 DNA binding domain
PfamPF105518.5E-26420514IPR018289MULE transposase domain
PROSITE profilePS509669.916688735IPR007527Zinc finger, SWIM-type
PfamPF044341.1E-4688732IPR007527Zinc finger, SWIM-type
SMARTSM005754.8E-4710737IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 841 aa     Download sequence    Send to blast
RAPGIPSPTP NPNPAPCPAP APKTLALNPR IQPIPPPIPA ISRRSGDPPD LDRFLRRRPT  60
LGCLGCPESS VLVHFLSRTD TPIPSILQSV AGLFPAGCLF PAKFRFSGSC LVSMEFEGEG  120
GIGVGVGDGE GDDRVDEPTR CLRCGISANA TPHMRRGPMG RRTLCNACGI AWAKGKLRKV  180
IDSDTPIDDV PVAKMVPEVG MEFDNEDKAY EFYNRYAGHI GFSVRKSSSD KSADNITRSR  240
TFVCSREGFR KDKKGANEVK RPRPETRIGC PARMIIKITS YNKYRIAEFV ADHNHQPAPP  300
STMHMLRSQR VLTEVQTTEC NSSEDSTTPS RFSGGSLGQQ AGAFRNVNFL PADYRSSLCS  360
KRTKNMQPGD AGGVVKYLQS MQLNNPSFFY AVQLDEDDKL TNIFWADSKS RVDFSYFSDV  420
VCLDTTYKIN AHGRPLTLFL GVNHHKQISI FGAALLYDES VESFKWLFDT FKIATDGKQP  480
KTILTDQSIA ASAAISAVWP STIHCLCPWQ VYQNTVKHLN HIFQGSKTFA KDFSRCVYDY  540
EDEEGFLVGW RTMLEKYDLR NNEWLHKLFE DRDKWASAYN RHVFTADING SLQLECVSNV  600
LRKYLSPQFD FLSFFKHYER VLDEHRYAEL QADFHASQSF PRIPPSKMLK QAANIYTPVV  660
FEKFRREFEM FVDSVIYSCG ESGTASDYRV AVTDRPGEHY VRFDSSDLSV ACSCKKFESM  720
GIQCCHVLKV LDFRNIKELP QKYLMRRWTK DAKSADRGNQ EFLSDGALQT PSSRLNVPVP  780
IINQPQSHLN NDHDHAASVS SFGHQALQGN ANGNQGYTPL AGMNQQPFVG GFPLNHETGF  840
E
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15157DRFLRRR
2259263KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2493010.0AK249301.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf33i23, mRNA sequence.
GenBankAK2518850.0AK251885.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf133l23, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985481.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
TrEMBLW5DW330.0W5DW33_WHEAT; Uncharacterized protein
STRINGLOC_Os03g08370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-115FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]